Essays on spirituality, society, and what is actually real — by Darryl Prusak.https://whatsreal.life/https://whatsreal.life/spirituality/why-does-the-world-seem-so-divided/https://whatsreal.life/spirituality/why-does-the-world-seem-so-divided/One World, Two Paradigms In 2012, something very rare, but cyclical happened. A new paradigm began merging with the old paradigm we have been living for many, many lifetimes. Some would refer to the new paradigm as the Light Paradigm and the old as the…Thu, 19 Mar 2020 19:39:09 GMTSpiritualityhttps://whatsreal.life/spirituality/how-to-raise-your-vibrational-frequency/https://whatsreal.life/spirituality/how-to-raise-your-vibrational-frequency/This is a very important piece in overall human-spiritual being understanding. We have all heard the terms "state of being" and "higher" vs "lower" vibrations, and even have aspired to "raise our vibration", but what does that really mean? For most of us it's a…Mon, 05 Aug 2019 02:38:12 GMTSpiritualityhuman frequency oscillation fieldoscillationstate of beingvibrationhttps://whatsreal.life/spirituality/the-3-archetypes-of-human-spirit-beings/https://whatsreal.life/spirituality/the-3-archetypes-of-human-spirit-beings/When I originally started this blog (so many years ago), it was actually to write about the 3 archetypes. For some reason, I only managed to squeak out an awkward piece summarizing the three. It's still available if you dig back far enough, but is…Thu, 25 Jul 2019 08:17:39 GMTSpiritualityamplifierarchetypeschannelerdarknessgroundingnullifierSPONGEthoughtstransmuterhttps://whatsreal.life/spirituality/why-kill-the-ego/https://whatsreal.life/spirituality/why-kill-the-ego/Often times you'll find spiritual "gurus" talking about the Ego, and they don't have very nice things to say about it. They'll tell you that you must transcend the Ego, shed it, leave it behind, or even that you must kill the Ego! *gasp* "Death…Wed, 24 Jul 2019 05:53:35 GMTSpiritualityegofaithhttps://whatsreal.life/spirituality/what-is-the-darkness/https://whatsreal.life/spirituality/what-is-the-darkness/The darkness... evil... fear... hate... horror... but what is it and where does it come from? In a recent social media post, a person asked: If God is Unconditional Love, then what is Darkness? It's a fair question, although its premise is inaccurate. Many try…Mon, 08 Jul 2019 19:54:28 GMTSpiritualitydarknessEVILfearhttps://whatsreal.life/society/ending-the-war-between-the-right-and-the-left/https://whatsreal.life/society/ending-the-war-between-the-right-and-the-left/In today's polarized world, we hear a lot of talk about the "far left", "far right", and not much at all anymore in the middle. It would even seem that the bar has moved so far to the left, that being slightly right of center…Fri, 07 Jun 2019 08:00:32 GMTSocietypoliticalhttps://whatsreal.life/spirituality/from-a-gods-perspective/https://whatsreal.life/spirituality/from-a-gods-perspective/Last night, I dreamt of a God. Moreso... I dreamt from the God's perspective... distinctly not myself, I was experiencing things from the God's point of view. As dreams often go, there was much going on that I experienced, but cannot place into a 3D…Tue, 21 May 2019 21:54:00 GMTSpiritualitygodhttps://whatsreal.life/spirituality/what-does-grounding-do/https://whatsreal.life/spirituality/what-does-grounding-do/Lately it would seem my life experiences are culminating into a singular clear vision... a vision that both reveals what's at the root of humanity's discord and the path to our salvation from it. Thats a tall order I know... but as it tends to…Sun, 17 Feb 2019 21:57:57 GMTSpiritualitydarknessgroundinghttps://whatsreal.life/spirituality/inspirational-video-everything-is-always-working-out-for-me/https://whatsreal.life/spirituality/inspirational-video-everything-is-always-working-out-for-me/I made this video some years ago during Christmas including my family in the process, my children are in the video as well, its our family inspirational video that we play every time we get in the car... every time we set out for anything…Sat, 16 Feb 2019 17:52:49 GMTSpiritualityabrahamesther hickshttps://whatsreal.life/spirituality/how-to-transcend-betrayal/https://whatsreal.life/spirituality/how-to-transcend-betrayal/Be•tray•al bəˈtrāəl,bēˈtrāəl noun: betrayal ; plural noun: betrayals the action of betraying one's country, a group, or a person; treachery; disloyalty, treachery, bad faith, faithlessness, falseness, duplicity, deception, double-dealing Everyone experiences betrayal, from small ones to grand ones, betrayal is currently a common human phenomenon…Tue, 29 May 2018 16:28:35 GMTSpiritualitybetrayaltranscendhttps://whatsreal.life/society/the-illusion-of-ownership-a-story-of-paper/https://whatsreal.life/society/the-illusion-of-ownership-a-story-of-paper/This is a satirical article taking a critical look at the foundation of our society: paper. You know, its quite an interesting concept we've created. This is mine, that is yours, I like yours, gimme some of yours, no? Well what if I trade you…Mon, 11 Sep 2017 06:24:21 GMTSocietyownershiphttps://whatsreal.life/spirituality/what-are-thoughts/https://whatsreal.life/spirituality/what-are-thoughts/Have you ever contemplated the nature of these things we call thoughts? What are they? Where do they come from? Most people go throughout their life never considering their relationship to their thoughts. Yet an awareness of their true nature exists in our languages. I…Sun, 18 Jun 2017 16:24:20 GMTSpiritualitythoughtshttps://whatsreal.life/spirituality/can-you-trust-the-thrive-movement/https://whatsreal.life/spirituality/can-you-trust-the-thrive-movement/For those of you who don't know, Thrive Movement was put together by Foster Gamble and his wife Kimberly. The foundation of this movement is explained in the documentary THRIVE: What On Earth Will It Take? (video above) In todays world, we often ask ourselves…Wed, 10 Feb 2016 17:22:36 GMTSpiritualityTHRIVEhttps://whatsreal.life/spirituality/the-next-revolution/https://whatsreal.life/spirituality/the-next-revolution/While its easy to see all the negativity and darkness inherent in today's society, that doesn't mean what is now is what will always be. Many people get lost in the feeling of hopelessness when they look at our society's current state. However, there is…Thu, 06 Nov 2014 01:57:08 GMTSpiritualityrevolutionhttps://whatsreal.life/society/the-truth-about-taxes/https://whatsreal.life/society/the-truth-about-taxes/Wow... OK. That was ... intense. I like the above video because it comes from a man that sees the insanity of the "system" we are all "governed" by and he has the courage to say it like he sees it. You can tell its…Wed, 16 Apr 2014 00:32:29 GMTSocietygovernmentslaverytaxeshttps://whatsreal.life/relationships/10-steps-to-a-healthy-relationship/https://whatsreal.life/relationships/10-steps-to-a-healthy-relationship/I've always appreciated the wisdom coming from Eckhart Tolle ... the intelligent, compassionate humor factor is what strikes me in his many talks. In my own experiences of communicating with the God/Universe energy, I have delighted in the fact that the communication that comes through…Thu, 27 Jun 2013 14:57:54 GMTRelationshipsrelationshiphttps://whatsreal.life/society/government-vs-or-by-the-people/https://whatsreal.life/society/government-vs-or-by-the-people/In the news today, both mainstream and alternative, you'll find ample stories depicting The Government as some entity of its own, as if it had its own life... made its own decisions. You'll find The People responding to The Government as if to confirm this…Mon, 24 Jun 2013 16:16:26 GMTSocietygovernmentslaverytyrannyhttps://whatsreal.life/society/prism-fact-or-fiction/https://whatsreal.life/society/prism-fact-or-fiction/The global media is buzzing with news about the alleged top secret classified project code-named PRISM . The people are outraged at the thought that the U.S. government has allegedly put together a program to read and store data on countless citizens world-wide. Is this…Thu, 20 Jun 2013 18:29:14 GMTSocietyPRISMhttps://whatsreal.life/society/iran-and-israel-a-love-story/https://whatsreal.life/society/iran-and-israel-a-love-story/Why I still hope for humanity You know, with all the psychotic things our governments do, its easy to lose faith in humanity. But a story like this one reminds me of one simple factor: Our governments are not representative of our humanity. Humanity lives…Tue, 16 Apr 2013 20:29:44 GMTSocietyHOPEIranIsraelhttps://whatsreal.life/spirituality/what-hope-means-to-life/https://whatsreal.life/spirituality/what-hope-means-to-life/Hope is an interesting concept really. It presumes that the Human is already in distress, doesn't it? I mean why would one even need Hope unless they were experiencing some form of suffering. If your life was just peachy, with nothing but peace, joy and…Sat, 01 Sep 2012 02:12:10 GMTSpiritualityHOPEsufferinghttps://whatsreal.life/spirituality/if-this-doesnt-bring-you-to-good-tears/https://whatsreal.life/spirituality/if-this-doesnt-bring-you-to-good-tears/Girl hears for the first time at age 29 Born deaf, this girl got implants that fixed her sense of hearing! Amazing what we Humans CAN do when we focus on making this world a better place for all. Wouldn't it be nice if this…Mon, 27 Aug 2012 17:42:59 GMTSpiritualityhttps://whatsreal.life/spirituality/5-peeps-1-guitar-human-creativity-vs-human-loathing/https://whatsreal.life/spirituality/5-peeps-1-guitar-human-creativity-vs-human-loathing/I really appreciate the great beauty of human expression in this video. Such creativity and talent, it reminds me that even though our society tends to sensationalise the darker side of life, there are still so many wonderful and beautiful things out there, and much…Wed, 22 Aug 2012 20:57:56 GMTSpiritualityhuman self-loathingUnconditional Lovehttps://whatsreal.life/spirituality/the-human-can-what-does-it-mean/https://whatsreal.life/spirituality/the-human-can-what-does-it-mean/The Obvious As I mentioned before, I had found the perfect domain name for this project, but without explanation, you won't fully grasp what I mean. So lets start with the obvious: "Whatever the mind can conceive and believe, it can achieve." -- Napolean Hill…Sat, 18 Aug 2012 18:11:33 GMTSpiritualityhttps://whatsreal.life/technology/why-nikola-tesla-was-the-greatest-geek-who-ever-lived/https://whatsreal.life/technology/why-nikola-tesla-was-the-greatest-geek-who-ever-lived/If only history classes in the "school system" were so historically accurate, educational and entertaining hahaha from: http://theoatmeal.com/comics/teslaThu, 16 Aug 2012 23:44:38 GMTTechnologyhttps://whatsreal.life/society/entertaining-video-on-the-reality-of-the-federal-reserve/https://whatsreal.life/society/entertaining-video-on-the-reality-of-the-federal-reserve/I like these comical videos which educate us on our current reality, because I really do not take it all so seriously. Its very easy to get all worked up and upset about these things, and perhaps you need to for awhile in order to…Thu, 16 Aug 2012 19:01:50 GMTSocietyhttps://whatsreal.life/society/government-for-dummies/https://whatsreal.life/society/government-for-dummies/My Thoughts I do really appreciate this video, its cute, funny, smart, and really does a good job at getting people to see the ludicrous nature of the society in which we live. It has its place, like all things, and from that level, I…Thu, 16 Aug 2012 16:48:26 GMTSocietygovernmenthttps://whatsreal.life/spirituality/tesla/https://whatsreal.life/spirituality/tesla/Nikola TeslaTue, 14 Aug 2012 22:03:30 GMTSpiritualityNikola Teslahttps://whatsreal.life/spirituality/what-does-ohm-look-like/https://whatsreal.life/spirituality/what-does-ohm-look-like/Tue, 14 Aug 2012 22:01:02 GMTSpirituality